Description
LL-37 5mg Peptide
Product Overview
LL-37 is a synthetic version of the naturally occurring human cathelicidin antimicrobial peptide. It is composed of 37 amino acids and plays an important role in innate immune system research. Due to its broad biological activity, LL-37 has become a widely studied peptide in scientific investigations involving antimicrobial mechanisms, cellular signaling, inflammatory pathways, tissue regeneration, and host-defense responses. http://reddit.com
LL-37 5mg is supplied as a lyophilized powder intended strictly for laboratory research purposes. Each vial undergoes rigorous quality control procedures to ensure identity, purity, and consistency. http://google.com
Researchers continue to investigate LL-37 because of its unique ability to interact with bacterial membranes, influence immune responses, and participate in wound-healing related pathways.
Product Information
Product Name: LL-37
Quantity: 5mg per vial
Appearance: White Lyophilized Powder
Grade: Research Grade
Purity: ≥98% (HPLC Tested)
Storage: Store at -20°C
Molecular Type: Synthetic Peptide
Intended Use: Laboratory Research Only
Reconstitution: Sterile laboratory-grade solvent
Technical Details
| Specification | Details |
|---|---|
| Product Name | LL-37 |
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | ~4493.3 g/mol |
| Purity | ≥98% |
| Analysis Method | HPLC & Mass Spectrometry |
| Appearance | White Lyophilized Powder |
| Storage Temperature | -20°C |
| Form | Lyophilized Peptide |
| Research Category | Antimicrobial Peptide Research |
Chemical Structure
LL-37 is a linear cationic peptide consisting of 37 amino acids derived from the C-terminal region of the human cathelicidin antimicrobial peptide precursor (hCAP18).
Amino Acid Sequence
[LL-37, 37 aa]
Structural Characteristics
- Amphipathic alpha-helical peptide
- Positively charged antimicrobial peptide
- Member of the cathelicidin peptide family
- Interacts with microbial membranes and cellular receptors
CAS Number
CAS Number: 154947-66-7
Chemical Formula
Chemical Formula: C205H340N60O53
Common Research Applications Include
Researchers investigate LL-37 in studies related to:
- Antimicrobial peptide mechanisms
- Host defense system research
- Innate immune response studies
- Cellular signaling pathways
- Tissue regeneration research
- Wound-healing investigations
- Biofilm interaction studies
- Inflammatory pathway analysis
- Microbial membrane disruption research
- Skin biology research
These applications remain areas of active scientific investigation and should not be interpreted as approved therapeutic uses.
Purity, Testing & Quality Assurance
Quality assurance is a critical component of peptide manufacturing.
Each batch of LL-37 5mg typically undergoes:
- High-Performance Liquid Chromatography (HPLC) testing
- Mass Spectrometry verification
- Identity confirmation
- Purity analysis
- Visual inspection
- Batch traceability procedures
- Manufacturing quality control review
Quality Standards
- Minimum purity of ≥98%
- Research-grade manufacturing process
- Strict laboratory handling procedures
- Batch-specific analytical testing
Packaging Information
Each order typically includes:
- 1 x LL-37 5mg lyophilized peptide vial
- Protective packaging
- Batch identification labeling
- Storage recommendations
- Available Certificate of Analysis (COA)
Packaging is designed to maintain peptide integrity during transport and storage.
Request the Current COA
Researchers are encouraged to request the most current:
- Certificate of Analysis (COA)
- HPLC Chromatogram
- Mass Spectrometry Report
- Batch Testing Documentation
Obtaining current analytical documentation ensures transparency and verification of product specifications before research use.
Storage Recommendations
For optimal stability:
Long-Term Storage
- Store at -20°C
- Protect from moisture
- Protect from repeated freeze-thaw cycles
- Keep vial tightly sealed
After Reconstitution
- Follow laboratory storage protocols
- Minimize contamination risk
- Use sterile handling techniques
- Store according to established research guidelines
Why Researchers Choose LL-37
LL-37 remains one of the most extensively studied antimicrobial peptides due to:
- Broad scientific interest
- Well-characterized structure
- Extensive published literature
- Importance in innate immunity research
- Diverse biological interactions
- High relevance in host-defense studies
Its multifunctional nature continues to make LL-37 a valuable peptide in advanced laboratory investigations.
For authority building and SEO enhancement, consider linking to: https://zhangpeptides.com.au
- National Center for Biotechnology Information (NCBI)
https://www.ncbi.nlm.nih.gov - PubMed
https://pubmed.ncbi.nlm.nih.gov - National Institutes of Health (NIH)
https://www.nih.gov - UniProt
https://www.uniprot.org - Protein Data Bank (PDB)
https://www.rcsb.org - ScienceDirect
https://www.sciencedirect.com - Nature Research
https://www.nature.com - Wiley Online Library
https://onlinelibrary.wiley.com
Precautions
- For laboratory research use only.
- Not intended for human consumption.
- Not intended for veterinary use.
- Not intended for diagnostic purposes.
- Keep out of reach of unauthorized personnel.
- Handle using proper laboratory procedures.
- Wear appropriate personal protective equipment.
- Store according to recommended conditions.
Disclaimer
LL-37 5mg is sold strictly for research and laboratory purposes only. This product is not approved for human or animal consumption, medical use, therapeutic application, diagnosis, or disease treatment. Purchasers are responsible for ensuring compliance with all local regulations and research guidelines.
Conclusion
LL-37 5mg is a highly researched antimicrobial peptide valued for its role in innate immunity, host-defense mechanisms, and cellular signaling investigations. Manufactured to high purity standards and supported by analytical testing, LL-37 remains an important research tool for laboratories conducting advanced peptide studies. Researchers seeking reliable peptide materials should always verify current batch documentation, purity reports, and Certificates of Analysis prior to use.
Reviews
There are no reviews yet.